Leah Tackles

  • Home
  • About
  • Policy
  • Beauty
  • Fashion
  • Cooking
  • Exercise
  • DIY Projects
  • Decor
  • Book Club
  • Family

Fun Target Haul! Shoes and Bag!! Splurge vs. Steal Comparisons!

March 25, 2015 & 1 Comment

Hi there! Happy Wednesday!

Thank you SO much for the support I recieved for my YouTube launch Monday! If you missed it, check out my first YouTube Video, the Mr. and Mrs. Challenge, with my hilarious and supportive hubs : )

Target has some AMAZING things right now!! And two things that I was swooning over from Chanel and Rebecca Minkoff? Well I found two affordable, designer inspired options at Target (Tar-jaaay!).

 

TARGET HAUL:

targetshoeshaul-spraing2015-leahtackles.jpeg

 Dianne Cap Toe Espadrille Flat in Brown/Black:

targetespadrilles-spring2015-leahtackles.jpeg

chanelespadrilleslookalike-leahtackles.jpeg

Okay, first of all, how much do these look like the much coveted Chanel espadrilles?! AMAZING! Second, I reeeeally wanted cream, but they weren’t in stock when I purchased these, but as long as these seem comfortable I want to grab the cream and maaybe blacks too. I love espadrille flats in the spring and summer!! And these are the most gorgeous ones I’ve found at an affordable price. Now, they clearly aren’t Chanel quality, but they seem comfortable so far. I did order my normal size, and they fit, but if I get more I will go half a size up (I should have read the reviews! whoopsies!).

Tameka Elastic Quarter Strap Sandals in White:

targetsandals-spring2015-leahtackles.jpeg

At first I wasn’t sure if the elastic strap was going to be way too old (err okay I’ll just say it: grandma-ish) for my taste, but it’s actually such a cute sandal on! I love how it nods to the Birkenstock which made a huuuge comeback in 2014, but has a new twist. This shoe is seems very very comfortable, but I have only worn it around the house because we STILL have snow here. That’s another story! I can’t wait to wear these!

Lakitia Embellished Sandal in Glitter:

targetshoehaul-spring2015-leahtackles.jpeg

I wanted the version of these from last year but didn’t order in time so I ended up with a metalic gold strapped pair that I wore more than any other sandal last summer! So, if you like these I would get them fast! I was able to slide my food in and out of the pair from last year without buckling them (wooohoo! especially for other moms out there!) AND I wore these to the zoo, parades, and other all-day events without blisters! I hope this adorable pair performs as well as the version I got last year.

Backpack Handbag in Black:

targetbackpackpurse-leahtackles.jpeg

backpackpurse-splurgevssteal-leahtackles.jpeg

I promise, this link is not doing this bag justice! I saw this in-store, fell in love, but walked away…which I OF COURSE immediately regretted! I am talking was googling this baby minutes after leaving the store, but it wasn’t online yet. As I’ve noticed before with Target, items seem to hit stores first and then about a week or so after will be up online. I ordered it. How could I say no for $29 when the similar Rebecca Minkoff I was lusting over was $300?! Years ago I didn’t like carrying purses that were not designer, but I’ve changed my tune! The quality of bags from places like Target has gone up, and let’s be real I have a budget! This bag is going to get a lot of use! There is so much storage, and enough room for a few diapers, a bottle, a lovey…all the things I have to tote around : )

Thank you SO MUCH for reading! If you enjoy this post PLEASE share, subscribe if you haven’t already, and “pin”! I appreciate it very much! And don’t forget to subscribe to my YouTube channel! Everytime I get a new sub it makes my day!! XO

FacebookTwitterEmailPinterestShare

Filed Under: Fashion Tagged With: Backpack Purse, Chanel Espadrille, fashion blogger, leah tackles, Purse Haul, Shoe Haul, Splurge vs. Steal, Target Espadrille, Target Haul

YouTube Launch! Mr. & Mrs. Challenge VIDEO!

March 23, 2015 & Leave a Comment

Hi there! Happy Monday!

Thank you, as always, for being here! I am very excited to announce that I put up my first real LeahTackles YouTube video!! I have wanted to start up a YouTube channel for a loooooong time now, and decided it was finally time! I will still be doing blog posts every Monday and Wednesday, but I will now also be uploading videos on my Leah Tackles YouTube Channel!! I do not have a set schedule for YouTube yet, but once I get the editing and filming down a little more, I will also give you a schedule for video uploads! You know I love consistency ; )

My first video is a very short (and hopefully sweet!) tag video with my husband called the Mr. & Mrs. Challenge. So, if you want to see us interact and answer a few questions about who is better and what, head over to my channel! Also, please please please subscribe and “like” my video! There is a big red subscribe button and all you have to do is click it! If you have a gmail account, you have a YouTube account, so whatever your email log in is will also log you in on YouTube 🙂

Thank you again so much for the support! I am nervous but also super excited to branch out! I know I have a ton to learn and can’t wait to get started : )

XX

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: beauty blogger, fashion blogger, First YouTube Video, leah tackles, Leah Tackles YouTube, Lifestyle Blogger, Mr. & Mrs. Challenge

POPSUGAR MUST HAVE BOX FEBRUARY 2015!

February 23, 2015 & 1 Comment

Hi there! Happy Monday!

Thank you for being here and making me part of your day : ) Today I want to share my PopSugar Must Have Box for February with you. Once again I am disappointed with the shipping :/ It wasn’t AS bad as last month, but I got this box several days after a friend who lives in the same state, and after Valentine’s Day which this box was strongly themed around. With that said, I LOVELOVELOVE this months box, and will still use every single item, but I wish the shipping would improve to how it was a year or so ago. I have been subscribed for 26 months and shipping has seemingly gone downhill. So, the dates of delivery really seem to vary, but *usually* the PopSugar box usually arrives between the 10th-15th of every month for me…it ships from California via FedEx Smart Post, which means it goes out FedEx but arrives to my P.O Box.

If you don’t know, the box contains full size, premium quality items in all different categories: food, beauty, fashion, home, and sometimes an extra goodie too! Each box boasts a retail total of $100 or more. You can check out my review of the PopSugar Must Have Box for January 2015 here.

The February box was inspried by, “One Love, Hearts & Arrows, Red Hot, Devine Desserts, and Pampering”  (a.k.a Valentine’s Day ; ) ) …ummm yes please!!

February Must Have Box:

februarypopsugarmusthave-leahtackles.jpeg

februarypopsugarmusthaveboxreview-leahtackles.jpeg

*Note: Rose Water Bubble Bath by U.S Apothecary NOT shown because it arrived (very) damaged

Amazonian Clay 12-Hour Blush by Tarte Cosmetics in  True Love:

amazonianclayblushtruelove-popsugarmusthavereview-leahtackles.jpeg

I was instantly over-the-moon excited by this box when I saw this! Obviously, I reeeeally love makeup, and Tarte is an amazing brand! I own a holiday blush palette from Tarte, but until now did not own any of the individual Amazonian Clay blushes. I love this shade, and it wears beautifully for a very natural flush that can be built up as needed. It is great that just a tiny tap into this is all you need because it is so highly pigmented, and this could be worn on many skintones.

$26

Rose Water Bubble Bath by U.S Apothecary:

IMG_4349 usapothecaryrosewaterbubblebath-popsugar-leahtackles.jpeg

This was a huge letdown because mine was broken : ( It leaked badly and my whole box smelled strongly of roses, but thankfully it didn’t damage my other items except the burlap bag that the next item was in. I appreciate that PopSugar always is sure to wrap items like this incase this happens, but I was still bummed! I contacted PopSugar first by email, but then recieved a much faster response by reaching out on social media. I have had two or three other issues over the course of 26 months, and always get excellent customer service once I get ahold of someone at PopSugar. If this happens to you I suggest sending a *nice* tweet to @MustHaveSupport or a Facebook message to the PopSugar Must Have Facebook page. I look forward to trying this when I get my replacement!

$30

Bamboo Heart Cutting Board & Cheese Knife by ACME Party Box Company:

I swoon over the ACME Party Box Company website, they have fantastic but fairly pricy gift ideas for everyone, and things themed for any party or celebration you could imagine! I love making little cheese and snack platters to make a night of Netflix with Stephan a little more special, so this is perfect for that! I love that this came with a little cheese knife, too!

*Similar item linked

$32

Mini Arrow Pendant Necklace by Bauble Bar:

baublebararrownecklace-popsugarmusthave-leahtackles.jpeg

Just like the Tarte blush, I was estatic when I saw something from Bauble Bar! I adore Bauble Bar jewelry! This little arrow necklace so dainty and cute! I think this would be adorable layered with other small necklaces, or worn alone. You can wear it at two different lengths, and I found that it laid better on the shorter length for me. This is definitely a new favorite for me, and my 3 year old Hailey gave it her nod of approval as well ; )

*Similar item linked

$32

100% Natutral Blam by Figs & Rouge in Lemon Berry:

figandrouge-lipbalm-leahtackles.jpeg

This has such cute packaging! I really like the ever ever so slight tint and feel of this. Although I love the look of a tin style balm, I don’t like dipping my finger into it unless I have something to immediately wipe my finger off on, so I end up using balms like this less than ones in tube form. I also feel like they are less sanitary. I really like the Lemon Berry color/flavor that I got, but if you’re subscribed what kind did you get? Leave me a comment and let me know, I love hearing what other variations people received!! : )

$8

Ravishing Rocky Road Bar by Chuao Chocolatier:

chuaochocolatier-popsugarmusthave-leahtackles.jpeg

OH MY GOSH YUM!!! Salted, caramelized almonds, and marshmallows in all-natural milk chocolate? Yes, yes, yes!! This is soooo good! I was really sad when it was gone! And Steph, who isn’t a big sweets or milk chocolate fan typically, also really enjoyed the small piece I shared ; ) I think these would be awesome as a gift add-on, or a sweet thing to send to a friend or loved one…maybe a Galentine!

$6

FingerPaints Nail Color by Sally Beauty in Romanticism Ruby:

This is a special extra and what a fun one! I love nail polish, and this is a brand I’ve never tried, so I can’t wait to try something new. I think Romanticism Ruby will be a great toe color! If you’re a PopSugar subscriber, what color did you get?

$5.50

I am THRILLED with the items in this months box, but I am frustrated with the shipping and my broken item as well. I hope that PopSugar can turn it around quickly so that I can start enjoying my box and sharing with all of you in a timely manner. This box has a retail value of $139.50 which is $100 more than the cost of the box. It really is like Christmas every month! Do you subscribe to PopSugar? What did you think about this box? Let me know in the comments! If you’d like more information on PopSugar you can find it here.

Have a great Monday!! XO

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Cooking, Fashion Tagged With: ACME Party Box Company, bauble bar, beauty blogger, Chuao Chocolatier, fashion blogger, Fig and Rouge, Finger Paints Nail Polish, Finger Paints Sally Beauty, leahtackles, Lifestyle Blogger, PopSugar Must Have, popsugar must have box, PopSugar Must Have February 205, PopSugar Must Have Review, Rose Water Bubble Bath U.S Apothecary, subscription box, Subscription Box Review, Tarte Cosmetics

Nursing Mama Style Tips: What I Wear While Breastfeeding! Part 1

February 16, 2015 & 3 Comments

Hi there! Happy Monday!

I hope that you all had a great Valentine’s with people who make your heart skip a beat! I had a very low-key weekend with my little loves (Hailey, Connor, and Logan), and of course my big love (Stephan).

I am exclusively breastfeeding our 5 week old and I forgot what a pain nursing fashion can be! If you think looking cute is hard pregnant, girl forget it and embrace that precious bump, because the first few weeks especially your breasts have to be easily accessable ALLTHETIME! So, today I want to share a few of the pieces I’ve been loving that are specifically for nursing, and in Part 2 of my Nursing Mama Style Tips I will share regular pieces that you can buy anywhere or may already have in your closest that work beautifully for nursing.

 

Long Sleeve Pull Over Nursing Hoodie by Motherhood Maternity:

motherhoodmaternity-nursingwear-leahtackles.jpeg

I love this for at home because I feel cute but am just rocking a thin cotton hoodie. This is a size small and I love it with legging or skinny jeans for a cute but very casual look. I also own this in gray.

Wrap Nursing Sweater by Motherhood Maternity:

motherhoodmaternity-nursingwrap-leahtackles-nursingstyle.jpeg IMG_4255

This is currently out-of-stock online but they do have other similar styles like this one. I love this because it doesn’t look like a nursing top, but it is SO easy to nurse in discreetly. If you really want some extra cover in public, throw a scarf on over it!

Faux-Leather Trim Black and White Striped Nursing Top by Milk Nursing Wear:

milknursingwear-nursingstyle-leahtackles.jpeg

I found Milk Nursing Wear because I was in love with Boob Design tops, but I just can’t bring myself to spend that much on a top that I’m only going to wear for nursing. But, if it in your budget, they are gorgeous and I’ve heard nothing but good things! Milk Nursing Wear is the same idea, but at lower prices. This top is so chic and easy to nurse in! It is INCREDIBLY soft, a rayon/ lycra blend, and is slightly longer in the back which I like. This is my favorite nursing top, and I can’t wait to dress it up with some fun jewelry! Milk Nursing Wear if you’re reading this PLEEEEASE make more options like this!

Nursing mamas, what do you wear? I would love more ideas! Stay tuned for Part 2! And please subscribe!!

FacebookTwitterEmailPinterestShare

Filed Under: Fashion Tagged With: breastfeeding style, breastfeeding wear, fashion blog, fashion blogger, leahtackles, mama blog, mom style blog, nursing fashion, nursing fashion tips, nursing mama style, nursing wear

EASY DIY NURSING CAMI/TANK TOP!

February 2, 2015 & 2 Comments

Hi there! Happy Monday!

Thank you as always for being here! I hope that you had a wonderful weekend!

As most of you know, I have a newborn baby, Logan, and 3 kids 3 1/2 years and under! I am nursing Logan, and need to be able to do so easily without fussing with my clothes. I own a couple of nursing tank tops from Motherhood Maternity and Target, but they are typically $25 each, and then you still need a cardigan or top to wear overtop. I need to have a ton of easy to nurse in stuff because every outfit I wear for the first few months especially has to be nursing friendly, so I turned to Google for some help! I found some tank tops by Undercover Mama, but they looked pretty simple to re-create, so I decided to google further for a DIY option.  I then found the blog BabyBellyKelli and her tutuorial on how to repurpose an old cami into a nursing cami. Her blog is really cute, so be sure to check it out : )

 

NURSING CAMI/TANK TOP DIY:

What You’ll Need:

nursingcamiDIYtutorial-leahtackles.jpeg

A cami style tank top

*TIP: I used some that I had from Forever 21. I like the ones *without* a shelf bra, but that is entirely up to your personal preference. If you don’t have any cami tanks you want to use, I definitely suggest the ones from Forever 21 because they are anywhere from $1-4 dollars each.

Thread (it’s nice if it matches the cami, but it won’t be seen by anyone but you so whatever you’d prefer)

Scissors

A Needle

A Clip Down Nursing Bra (My favorites are the Motherhood Maternity Seamless Bras or Sports Bras)

Step 1:

nursingtanktopDIY-leahtackles.jpeg

Lay the cami down and cut the straps at the back of the cami as close to the tank top as possible while being careful not to cut the cami itself.

Step 2:

nursingtanktopDIY-leahtackles.jpeg

On the front of the cami cut each strap so that about 2 inches of strap is left.

Step 3:

nursingtanktoptutorial-leahtackles.jpeg

nursingtanktopDIYtutorial-leahtackles.jpeg

Using your needle and thread sew the 2 inch strap into a loop. I doubled up my thread and tied a triple not at the end. I started on the inside of the cami and pushed the needle out so that the string was on the inside. I did about 5-7 stiches per strap just to be sure it would be very secure! The last thing you want to worry about while nursing, especially in pubic, is that your nursing tank isn’t going to hold up! Do this to both sides of your cami. I made 5 camis in about 30 minutes, it was really fast once I got going! Please excuse my messy stitches on the gray cami, it bothers the perfectionist in me, but hey nobody else will see it!

Step 4:

nursingtankDIY-leahtackles.jpeg

Put on a nursing bra and then unclip it. Put on your cami. Put the loop that you made over the clasp of the nursing bra and then reclasp your nursing bra. Ta-da! How awesome is that?!

I wanted to be sure to test out one of these before sharing this tutorial with you, and I nursed in public without any issue! This is actually EASIER to me than my other nursing tanks, because I just have to unclip my bra instead of unclipping both a nursing tank and nursing bra. I am thrilled with these results and now I just need to find some great, affordable cardigans to go over them to get me through winter with a new baby who looooves to eat!! : )

If you found this DIY tutorial helpful *please* “pin” this post to your Pinterest or share it with one of the button links at the bottom of this post! It’s super easy, promsie!

Don’t forget to enter my DIAPER GIVEAWAY for your chance to win 140 diapers! Have a fabulous week!!

FacebookTwitterEmailPinterestShare

Filed Under: Family, Fashion Tagged With: beauty blogger, blogger, breastfeeding, breastfeeding tank top, DIY nursing tank, fashion blogger, leah tackles, Leah Tackles Motherhood, leah tackles nursing, Mom Blogger, nursing cami, nursing cami/tank tutorial, nursing clothes, nursing DIY, nursing tank

Preppy Pink Shop Brand Rep AND Discount Code!!

January 26, 2015 & Leave a Comment

Hi there! Happy Monday!

Thank you for being here! I hope that you had a wonderful weekend!

Today I am *THRILLED* to announce that I am now a Brand Rep for Preppy Pink Shop, a fabulous shop that has amazing custom skirts that I swooned over in my post Meet My Newest Obsession: Preppy Pink Shop and See My Christmas Eve Outfit , gorgeous key fobs, adorable jewelry, and more! The Lily Pulitzer print skirts are perfection, too. Below I share some of my favorite items but to see more you can go to www.PreppyPinkShop.com or www.PreppyPinkShop.Etsy.com to see more of the beautiful items! I also am including a picture of the custom maternity skirt that I wore on Christmas Eve.  If you’d like to If you use the code PPSREP4 you can save 30%!

If you have any questions, please let me know!! Please be sure to SHARE THIS POST and SUBSCRIBE : ) XO

 

preppypinkshoprep-leahtackles.jpeg

preppypinkshop-customskirt-leahtackles-preppypinkshoprep.jpeg

 

 

 

 

FacebookTwitterEmailPinterestShare

Filed Under: Decor, Fashion Tagged With: Custom Skirt, fashion blogger, leah tackles, Leah Tackles Christmas, lily pulitzer, Lily Pulitzer Custom Skirt, Preppy Pink Shop, Preppy Pink Shop Ambassador, Preppy Pink Shop Brand Rep

POPSUGAR MUST HAVE BOX JANUARY 2015!!

January 21, 2015 & 3 Comments

Hi there! Happy Wednesday!

I finally got my hands on my PopSugar Must Have Box for January! My sweet friend (hey girl hey you know who you are! Don’t spit out your coffee if you’re at work!) got her box a whole week before me and we live in the same state. Hmm! So, the dates of delivery really seem to vary, but *usually* the PopSugar box usually arrives between the 10th-15th of every month for me…it ships from California via FedEx Smart Post, which means it goes out FedEx but arrives to my P.O Box.

If you don’t know, the box contains full size, premium quality items in all different categories: food, beauty, fashion, home, and sometimes an extra goodie too! Each box boasts a retail total of $100 or more. You can check out my review of the PopSugar Must Have Box for December 2014 here.

I didn’t get the sheet with information about what inspired each product, which was a bit of a bummer because I like jumping into the box and being surprised but then reading about each item. I looked up this months inspirations for the box and it said, “Rejuvenate, Fresh Start, Snow, Glimmer, Energize and Refresh”.

 

January 2014 Must Have Box:

popsugarmusthavebox-january2015-leahtackles.jpeg

Pom Pom Hat by Jack + Lucy

jackandlucy-popsugarmusthavebox-leahtackles.jpeg

I love this!! It’s a bit slouchy and more “hipster” than what I normally would wear, but it is super cute on!! I looove to wear gray and the pom pom is right up my ally! We got tech gloves Jack + Lucy in the January box for 2014 that I wear all the time and they’ve held up really well.

$32

12 oz Brew Glass Coffee Cup by KeepCup

keepcup-popsugarmusthave-leahtackles.jpeg

I love this! First of all, it fits under my Keurig which is great because a lot of travel mugs do not. The idea is that you can take these cups to your favorite coffee shop and they are the correct size for consistent proportions. I am curious about taking a cup like this to Starbucks…has anyone done this or tried to? But let’s be real, I usually am drinking/making coffee at home, and so I can definitely get a lot of use out of it.

$26

Skin Jewel Tattoos

skinjeweltattoos-leahtackles-popsugarmusthavebox.jpeg

I started seeing these last summer, and I’ll be honest the first time I saw them is when all of the girls on the total guilty pleasure of a show, Bachelor in Paradise, were rocking them. I think they’re fun, and would definitely wear a few on my wrists in the summer when I have a bit of a (fake) tan. Also, where were these when I was in college?! How freaking cute! I would have definitely worn these alllllll summa long at the pool.

$18

Protein Gronola in Peanut Butter N’ Dark Chocolate by Nature Valley

I am breastfeeding a newborn, so I am constantly needing simple snacks because I get so hungry so fast, and I think this will be a great option. I tried it and it tastes good, I bet it will be amazing with milk or almond milk!

$3.70

eQua Yoga Hand Towel by manduka

I am excited about this one! Once I get the all clear from my doctor to workout again after baby, I can’t wait to get back into shape, and this will be an awesome gym towel!! It says yoga but I can see myself using this after the treadmill or machines.

$16

Ice Water Eyes by ToGoSpa

icewatereyes-togospa-popsugarmusthave-leahtackles.jpeg

I love these! Did they know that I just gave birth?! Look for these in an upcoming Empties post where I let you know how they worked for me. I am hopeful ; )

$12.50

Ultra Repair Cream by First Aid Beauty

I keep seeing First Aid Beauty, and this product in particular, mentioned on other blogs I read and on YouTube videos that I watch but until now I haven’t had anything from the brand. I am thrilled to have this and can’t wait to try it out. And this is the big size, so it’s pretty nice that they gave us that and not the smaller $12 tube that is also avaliable.

$30

This box had a retail value of $138.20 and I think I will get use out of every single item in the box! I love PopSugar because it is a nice way to pamper yourself with things you probably wouldn’t buy yourself otherwise or may not know about otherwise. Do you subscribe to PopSugar? If you’d like more information you can find that right here! If you subscribe, did you enjoy your box? Please *COMMENT* to let me know!!! : )

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Cooking, Exercise, Fashion Tagged With: beauty blogger, eQua, fashion blogger, FIrst Aid Beauty, Ice Water Eyes, jack + lucy, Keep Cup, leah tackles, Lifestyle Blogger, Must Have Box, nature valley gronola, Pop Sugar Must Have Box, popsugar, Skin Jewel Tattoos, SpaToGo, subscription box, Ultra Repair Cream First Aid Beauty

If it makes you happy…

January 12, 2015 & 4 Comments

Hi there! Happy Monday!

Who remembers that song “If It Makes You Happy” by Sheryl Crow? When I decided that I wanted to share a few things in my room that make me happy, I couldn’t get that song out of my head! I am a big believer in making life as beautiful, enjoyable, and special as possible…life is short! Surround yourself in pretty things! A quick DIY or some washi tape can completely change something from ordinary to fab!! Thank you for being here! I hope that you had a wonderful weekend! *Hopefully* I have a brand new baby boy in my arms when you’re reading this, but as I write this he still hasn’t made his appearance. I will definitely be doing an introduction post to our new little man as well! Get ready for some picture posts!!

 

prettylittledetails-jewelrycatchall-leahtackles.jpeg

sequinhanger-leahtackles-prettythings.jpeg

pearlsandpastries-leahtackles-prettystuff.jpeg

essielove-leahtackles.jpeg

prettydetails-leahtackles.jpeg

leahtackles-prettylittlethings.jpeg

popfizzclink-prettylittlethings.jpeg

erincondren-leahtackles.jpeg

henribendelsnowglobes-leahtackles.jpeg

prettymakeupdrawer-leahtackles.jpeg

What pretty things do you surround yourself with? What have you been loving lately? I would *love* to hear from you! Enable me ; ) Have a great start to your week!! And please comment, subscribe, and share!!! It means SOOOOMUCH to me!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Decor, DIY Projects, Fashion Tagged With: bauble bar, baubles, beauty blogger, erin condren, essie, essie nail polish, fashion blogger, frixion color, jewelry, leahtackles, Lifestyle Blogger, pearls and pastries, Pop Sugar Must Have, washi tape

Christmas Pictures Post!!!

December 29, 2014 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a WONDERFUL Christmas if you celebrate and a wonderful holiday season no matter what you celebrate!! I lovelovelove Christmas and our tree will be up until the Epiphany on January 6th…even though this year that is making me a *little* nervous since baby boy is due January 9th! We saw Stephan’s parents on Christmas Eve, spent Christmas Day with just our little family, saw Stephan’s extended family on the 26th, and finally on the 27th we celebrated with my parents! We also had a small co-ed “Sprinkle of Love” for our baby boy over the weekend and that was such a great time! We are blessed!! Today I want to share some pictures and send love from my family to yours!! On Wednesday be ready for some of my favorite gifts of Christmas 2014!!

christmaseveOOTD-preppypinkshop-leahtackles.jpeg

decoratingcookies-christmas2014-leahtackles.jpeg

 

christmaseve2014-leahtackles.jpeg

christmaseve-leahtackles.jpeg

uncleshane-leahtackles-christmas2014.jpeg

mistletoekisses-leahtackles-christmas2014.jpeg

santacame-leahtackles.jpeg

kidkraftdollhouse-leahtackles-christmas2014.jpeg

cozycoupetruck-leahtackles-christmas2014.jpeg

christmas2014-leahtackles.jpeg

openingchristmasgifts-leahtackles.jpeg

connordavid-christmas2014-leahtackles.jpeghottiehubs-leahtackles-christmas2014.jpeg

connordavid-christmas2014-leahtackles.jpeg

haileyandpaige-christmas2014-leahtackles.jpeg

haileyandconnor-leahtackles-christmas2014.jpeg

haileychristmas2014leahtackles.jpeg

leahandsteph-leahtackleschristmas-2014.jpeg

leahtackleschristmas2014-leahtackles.jpeg

leahtackleschristmas2014.jpeg

girlfamilypic-leahtackleschristmas2014.jpeg

leahtacklessprinkle.jpeg

christmasjammies2014-leahtackles.jpeg

*Note: My Christmas Eve Outfit (pictured in the first photo at the very top of this post) is from Preppy Pink Shop! I did an entire blog post gushing on about her skirts, which you can find here, because she absolutely deserves it! She is fabulous, her work is fabulous, and I can’t wait to wear more of her skirts once I’m back in non-maternity clothes!!

Thank you for being a part of my life! Please subscribe and share! I am so excited for 2015!!! I want to take leahtackles places…starting with Etsy and Youtube!! MUUUUUAH!

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: beauty blogger, christmas 2014, family blogger, family christmas, fashion blogger, leah tackles, leah tackles christmas 2014, Mom Blogger, Preppy Pink Shop, Preppy Pink Shop Skirts

POPSUGAR MUST HAVE BOX DECEMBER 2014!! *BONUS POST*

December 19, 2014 & 1 Comment

Hi there! Happy Friday!!

Today I have ANOTHER bonus post because I got my December PopSugar Must Have Box and have to share it with you right away! It’s suuuuch a good one!

If you don’t know, the box contains full size items in all different categories: food, beauty, fashion, home, and sometimes an extra goodie too! *Usually* the PopSugar box usually arrives between the 10th-15th of every month for me…it ships from California via FedEx Smart Post, which means it goes out FedEx but arrives to my P.O Box.

 

December 2014 Must Have Box:

popsugarmusthaveboxdecember2014-leahtackles.jpeg

Speckled Metallic Scarf from SPUN by Subtle Luxury

popsugarmusthaveboxdecember2014-leahtackles.jpeg

I love this! Anything metallic, especially gold, catches my eye! I absolutely love this lightweight scarf and think it’s a great way to add a little sparkle to any outfit.

$62

Sydney Necklace from Sparkle Pop

sparklepop-popsugarmusthave-leahtackles.jpeg

This is by far my favorite thing in the box!! It is *so* sparkly! I was doing my monthly unboxing with my 3 year old, and she nearly broke my heart when she said “Mom! Check and see if there is another one in the bag” because she loved it so much, too. I couldn’t blame her, it’s stunning!

$42

Platinum Bowl by Canvas Duaville

canvasdauville-popsugarmusthave-leahtackles.jpeg

popsugarmusthavebox-december2014-leahtackles.jpeg

This bowl is plain matte white on the outside, but on the inside it is a super sparkly platinum! This looks PERFECT with the Sydney Necklace above tossed inside! I adore this for a jewelry catch-all.

$29

Be Legendary Long-Wear Lip Lacquer

smashboxbelegendary-leahtackles.jpeg

This deep bordeaux color is perfect for winter! I thought that staying power was great, and I haven’t braved it without a lip liner yet, but with a liner I didn’t have any bleeding or feathering. I really like this color, the gloss formula (again, my DRY lips need it!), and the stain it left was beautiful! Even after eating out at a mexican resturant!

$24

Parcel Tags from Knot & Bow

knotandbowparceltags-popsugarmusthave-leahtackles.jpeg

These little tags are cute! I think they would look adorable with a name written in gold sharpie : ) I don’t love these for Christmas gifts, but I like them for other gift giving, or labeling around the house! I love that these are from an etsy.com shop!

$4

Cupcake Mix in Vanilla Bean from William-Sonoma

williamsonomacupcakemix-popsugarmusthavebox-leahtackles.jpeg

I was hoping for some fancy smancy chocolate this month, but I am not complaining about this ; ) I love William-Sonoma cooking ware, but haven’t tried any of their mixes. Hailey, my 3 year old, LOVES to bake with me! So, we will have fun with these even though I wouldn’t pay this much for cupcake mix myself : )

$14.95

I looooove this box! The $175.95 total value is fabulous and I think this box is absolutely worth the $39 price!  Do you subscribe to PopSugar? If you would like to you can sign up here for $39/month! If there are any other subscriptions that you think I need to try, let me know in the comments or find me on social media! It’s always LeahTackles : ) Good luck getting all of your last minute Christmas shopping, baking, and wrapping done this weekend!!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Cooking, Decor, Fashion Tagged With: beauty blogger, Canvas Dauville, fashion blogger, Knot & Bow, leah tackles, Lifestyle Blogger, popsugar must have box, PopSugar Must Have Box December 2014, popsugarmusthave, Smash Box, Sparklepop, subscription box, Subtle Luxury, Williams-Sonoma

« Previous Page
Next Page »

SUBSCRIBE

Leave your email to subscribe!

SEARCH

SPONSORS

ARCHIVES

GRAB MY BUTTON


copy & paste code

site design by The Kinch Life Design & development by Olive & Ivy Design