Leah Tackles

  • Home
  • About
  • Policy
  • Beauty
  • Fashion
  • Cooking
  • Exercise
  • DIY Projects
  • Decor
  • Book Club
  • Family

BABIATORS SUNGLASSES REVIEW & GIVEAWAY!

May 25, 2016 & 15 Comments

Hi there! Happy Wednesday!

Memorial Day weekend is THIS weekend! How did that happen already? It’s blowing my mind that we are about to kick off the summer season, but I am so happy to get outside with my family! Summer means sunshine (hopefully! Here in Michigan you never really can tell) which means lathering the kids up in sunscreen, but we also can’t forget about protecting their eyes! I will totally admit that while I never skip shades myself because it drives me CRAZY when I forget them, I have skipped sunglasses for the kids in the past because they never seem to keep them on anyways. So, when Babiators reached out to me I was thrilled to try them out! It’s always full disclosure here, and I was provided a pair of sunglasses for consideration and review but all opinions are my own. I will not be paid if you purchase Babiators. Babiators also sent information for this blog post.  Babiators agreed to send a pair of shades to one of my readers! Yay! Keep reading to hear my thoughts and enter to win!

 

A Little Bit About Babiators:

-Babitators have UV 400 lenses that offer 100% UVA and UVB protection

-Babiators undergo rigerous testing to ensure they’re safe for your child whether on their face OR in their mouth

-Babiators are durable! They are made of a flexible rubber frames, and shatter-resistant lenses

– Babiators are guaranteed, so if you break OR lose them in the first year, Babiators will replace them and all you pay is shipping.

-And my favorite part? The fit is incredible! They’re made of a soft material that is comfortable and lightweight. They don’t pinch the temples or the nose. I wish I had sunglasses made from this stuff! It is seriously awesome!

Babiators Sizing:

Junior Babiator sunglasses for babies 6 months-3 years

Classic Babiator sunglasses for kids 3-7 years

Information About Sun Safety:

-UV damage is cumulative and irreversible

-Kids receive about three times more annual UV exposure than adults each year, yet less than 30% of parents are currently protecting their children’s eyes with sunglasses

-Children’s eyes are more susceptible to sun damage because they have larger pupils and clearer lenses, allowing more UV to penetrate and reach the back of the eyes

When getting sunglasses look for 100% UVA/UVB protection with a high quality frame and comfortable style that kids will actually wear and keep on!

My Thoughts:

I absolutely LOVE these shades! Logan, who is 16 months old, loves these and keeps them on! I love that they don’t squeeze his precious face. These are by far the nicest kids sunglasses we have ever tried. Logan is a pretty tough little guy, so it makes me happy that when he holds onto these I know they can bend instead of snapping in two. Logan also puts everything in his mouth, so I love knowing that they’re safe even when he does that. Logan is an above average little guy, and I think that he will be in the Classic Babiators by the time he is two years old.

Logan Modeling “You’re The Palm” Polarized Babiators:

babiatorssunglasses-review-leahtackles.jpeg

babiatorsreview-giveaway-leahtackles.jpegIMG_3890 IMG_3889 IMG_3888 IMG_3887 IMG_3886 IMG_3885 IMG_3884 IMG_3883

Check Out All the Adorable Options Here!

Giveaway:

If you would like to win a pair of classic black babiators for your little one, enter this giveaway!

Entering is EASY!

To Enter:

Subscribe to LeahTackles.com (that’s this blog!)

subscribetowordpressblog-leahtackles.jpeg

Comment on this post who you would like to win a pair for!

“Like” LeahTackles on Facebook

“Like” Babitators Sunglasses on Facebook

Extra Entry Opportunitys:

Follow LeahTackles on Twitter

Follow Babitators Sunglasses on Twitter

Tweet @Babitators that you entered @LeahTackles giveaway for #Babiators

Follow LeahTackles on Instagram

Follow Babitators Sunglasses on Instagram

“Pin” this post on Pinterest (*Note: It’s easy! Hover over any picture of use the share buttons at the bottom of this post!0

Follow LeahTackles on Pinterest

Follow Babiators Sunglasses on Pinterest

Rules:

-Must be 18 years old or have parental permission

-Must live in the United States

-Giveaway ends 3 weeks from today on June 15th at 12:00p.m Eastern Standard Time

-Winner will be randomly selected

-Winner will have 48 hours to respond before I go onto the next person

I hope that each of you have a fun and safe holiday weekend! If you have any questions, please ask! xx

FacebookTwitterEmailPinterestShare

Filed Under: Family, Fashion Tagged With: Babiators, Babiators Giveaway, Babiators Review, Babiators Sunglasses, Babiators Sunglasses Review, Baby Aviators, Baby Sunglasses, daily vlogger, family blogger, In The Palm of Your Hands Sunglasses, Kid Model, Kid Style, Kids Sun Safety, Kids Sunglasses, KwapisFamilyTackles, leahtackles, Lifestyle Blogger, michigan blogger, Mom Blogger, Mom Clothes Reviews, Mom Life, mom reviews, Mom Toy Reviews, mom vlogger, Polarized Babiators, Polarized Kids Sunglasses, Safe Kids Sunglasses, Toddler Model, toddler style

DEAR MOM of the HEALTHY CHILD | GUEST POST

April 20, 2016 & 2 Comments

Hi there! Happy Wednesday,

Hi! Thank you, as always, for taking time out of your crazy life to read! It means a lot to me : ) If you haven’t yet, please subscribe so that you will be notified via email when I post. Whenever I talk to people about this blog, one of the things I mention is that it is something that is mine. I am a mother of three, I am a wife, and I am BUSY!! So, this blog allows me a space where I don’t have to be only all about my family, but can talk about my beauty and lifestyle passions as well. Since starting this blog just over two years ago, I have also started a LeahTackles YouTube Channel where I share beauty hauls, makeup tutorials, and all sorts of other fun stuff similar to the content you read here. Last summer we took it a step further and decided as a family to document our lives on Our Daily Vlog Channel KwapisFamilyTackles. I talk about the kids from time to time on here and on my YouTube channel, but not I don’t share too much personal detail, but because we share our lives every day you would think I would be comfortable going into a lot of detail about our middle son, Connor, and his medical issues but it is so hard! I share bits and pieces, and appreciate all of the love! Who knows, as the journey continues we may as a family decide to share more : ) But, let’s get to my guest post! A friend from high school, who I sadly don’t get to see (girl, we need to make that happen!) but chat with pretty regularly on Facebook and who has been a champion of mine by rallying around me during trying seasons with Connor, reached out to me to see if I could help her share her story.

*Note: This story was not written or edited by me! And while I can relate to a TON of which she has to say, I would like to say that all statements and opinions are hers and may not be the same as mine. This is an amazing mom, wife, nurse, and all around fantastic human being.  I am thrilled to help out by giving her a place to share her beautifully and honestly written story. Please share this post so that your friends and family can see it too!

DEAR MOM of the HEALTHY CHILD

by Jennifer Barrantes

Dear Mom of the healthy child,

I love you. I love your spontaneity. I love your energy and your optimism and your routines. I am not jealous of your life, but I long for your regular-ness. I long for the usual and I long for the reliable. You see my son is sick. He looks fine. He isn’t dying. He isn’t fighting cancer. We are very fortunate and blessed. He has asthma. Not the “oh I used to have an inhaler for gym class when I was little,” type of asthma. It’s more like the cough until he throws up and can’t breathe, type of asthma. The, “I’ll start the treatment while you call 911” type of asthma.

 

He has spent many days of his young, nearly three year life in the hospital, doctor’s offices and emergency rooms. Hooked up to IV’s, heart monitors and oxygen tubing. He’s received endless steroids, breathing treatments, blood draws, antibiotics, antivirals and x-rays. I wouldn’t trade him for anything. He is tough as nails. He is my superman. Some of the best times him and I have had are around midnight, in the middle of the week, his laughter echoing through the hospital corridors, as we sit and watch an infinite line up of Disney movies. After the movies go out, we lay in the darkness of our hospital room. Our night light is his heart monitor and our entertainment is the pediatric unit’s fish tank. We nap all day with the quiet beeping of his monitor in the background as doctors, case workers and nutritionists file in and out. For as much fun as we have being out of our routine, out of our routine is exhausting.

 

You see, the treatment for restricted airways is albuterol. Albuterol is like a shot of caffeine… straight, inhaled. Talk about toddler to the max. I’d say, “Toddler on steroids…” but you see he’s on those too. So, caffeinated toddler on steroids. That’s not even fair. “Mom of the healthy kid” uses caffeine to REACH the energy level of her children. Once my son gets albuterol, all the coffee in the world couldn’t get me up on his level! He’s unreachable! Upon hospitalization he gets the treatments every two to three hours! If we are lucky enough to survive an asthma exacerbation at home, he gets the treatments every four hours. Moms, just know that albuterol always trumps caffeine.

 

Asthma isn’t the type of diagnosis that uproots you. Your jaw doesn’t drop and you don’t go into crisis mode instantaneously. We don’t have scheduled chemo or heart surgeries or physical therapy appointments. We are lucky for that. You see, asthma is a chronic illness. Asthma cannot be cured. It doesn’t end. It slowly wears you down. Our family has survived multiple ER visits and hospitalizations. It can get better and then worse again. We never know when it’s going to strike. It could be first thing in the morning or in the middle of the night. Its holidays, weekends and vacations. We don’t travel unless I know we are within minutes of a reputable hospital. You see his airways are so small right now that it could be anything at any time.

When your child doesn’t feel well, you want to give them whatever they want. This way they may feel better, if only for a moment. After all, it’s only temporary. For us, you could point to any random date on the calendar and chances are pretty good that would have been a “not so good” kind of day. Especially in the fall and winter months. Today …. I realized this. And I grieved. As I sit here in bed typing, his little body sleeps next to me. I can hear the lite whistle of his wheezes and the crackles of his chest. His lungs sound like crap. He stirs frequently and his coughs are in abundance. Today I didn’t grieve the loss of my child, I am blessed. I grieve the loss of an idea. The idea that this asthma crap was a temporary state.

 

Instead of going to yoga class, wine dates, girl’s night and the gym… I will be here. I will be where I am needed and we will struggle. I will have to move mountains to catch him up on his development. He will have to learn to use the potty, to read, to multiple and maybe even to drive a car…. While feeling unwell. Who knows how long it will last. I grieve the loss of my independence, I grieve the loss of my hobbies, I grieve the loss of my friends, but mostly I grieve the loss of an idea that I will not have a perfectly healthy child.

 

I’ve always thought, “I’ll wean his bottle when his asthma lets up. I’ll teach him to use the potty when his asthma lets up. I’ll teach him to share, to pray, to look both ways before crossing the street, to say please and thank you when his asthma lets up.” He is pushing 3 and his asthma hasn’t let up. I don’t want our life to center around him. I don’t want his sibling’s lives to revolve around him. I don’t want to put off teaching him how to share any longer. When he isn’t feeling well and I have to teach him to share, he’ll cry so hard he may have a hard time breathing. So I grieve. Am I making the right choices? How much damage am I causing now versus how much harder will it be to correct later? So many choices.

 

Did you know, that while pregnant the baby leaves fetal cells behind? In. Your. Brain! Imagine that…. No wonder people have developed the phrase, “moms have eyes in that back of their heads,” or “a mother’s intuition.” I have developed this uncanny anxiety which is closely related to the breathing of my child. As he is less able to breath, my anxiety gets to a breaking point where I grab my “go bag,” which is always at the ready. We race to the ER, they strap him up to an oxygen mask, filling it with breathing treatments and starting an IV. And he stares into my eyes the whole time. We just stare. I love him so. I love him so much my heart slows with his and my breathing slows with his. We made it. One more time. We are here in this place we love and hate so much. But we are here. We are safe. We are together.

 

We have good days too. SO many steroid free, albuterol free, sun shining, birds singing, finger painting on the back porch, kind of days. You can sure bet that we make the best out of those. We don’t waste time on the laundry. We swim, we sing, we learn the alphabet and we eat popsicles. Its summer now and he’s been steroid free for three months. Guess what? He is finally growing!

 

I’m not looking for sympathy. The other day I heard the best analogy for sympathy vs empathy.

 

So pretend I fell in a hole. Sympathy is standing at the top and yelling down, “hey do you need a flashlight and a sandwich? It’s looking pretty terrible down there.” Empathy is stopping what you’re doing, grabbing your ladder, climbing down into the dark hole with me and experiencing the fear together. The reason people cannot empathize is because they are afraid to feel that.

 

Mom of the healthy children, you’re probably thinking, “what do you want me to do? I don’t have time to find my ladder. I haven’t seen it since we bought our house. It’s probably buried under the dusty stroller and the bouncer chair now filled with cobwebs.” That’s okay. It’s not about the ladder anyway. When you’re tucking your healthy kids into their own beds at night just stop, look, listen and adore. For you are blessed. They are healthy. Don’t have sympathy for me, my child has not died. Just breathe the stress of the day off your shoulders and stare at those healthy, sleeping, angel faces and say a prayer. Thank God for your children and then say a prayer for mine. His breaths don’t come as easy and his dreams don’t flow as sweet. Dare to feel that anxiety with me, if only for a moment.

 

Did you stop and think about it? Think about your child struggling to breathe? Thank you. For now I am not alone.

 

The reason I write to you is this. I grieved today. It’s the two year mark of my son’s diagnosis. We have nearly lost him three times. I grieved NOT for the loss of my child. I am blessed. I grieved the loss of many things my child will never do. I grieved the loss of the idea that I too had a perfectly healthy child. It sounds so lame on paper. It sounds so lame out loud when you may not understand.

 

Mom of the healthy children, I am not jealous. I am not bitter. My life is so sweet and so beautiful and so spunky. I may turn down your jungle java dates and we may avoid birthday parties like the plague. If you took a moment above to empathize with my pain, now you understand. I love your schedules and your energy, your routines and your optimism. I love your grocery day and your play dates. I don’t have those. We tend to “fly by the seat of our pants” over here. So when our paths cross, give me a big hug and ask me how I am doing. Ask me about my sweet boy. Pull up two chairs, pour me some coffee and lend me your ear. I may need to vent, I may just need adult conversation and I will definitely need some encouragement. You see, in my eyes, my boy is perfect. In my eyes, our life is perfect. In my eyes, I am blessed to have been given this super hero who’s lungs can’t always keep up… and I will do anything to keep him here with us for as long as God will’s it.

 

 

Thank you for reading! Please leave your comments for Jennifer or myself! And leave a comment to support her for having the courage to share her story and positive message! Have a wonderful weekend : )

 

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: Dear mom of the healthy child, family blogger, Guest Post, KwapisFamilyTackles, leahtackles, Lifestyle Blogger, Mom Blogger, To The Healthy Mom

4th of July 2015! PIC HEAVY!!

July 6, 2015 & 2 Comments

Hi there! Happy Monday!

I hope that each of you had a safe and happy weekend! If you are in America, tell me in the comments what you did for the 4th! I would love to hear about it : ) We had a wonderful weekend and I have lots of pictures to share with you. We also have decided to start vlogging as a family, and we want to launch a FAMILY VLOG CHANNEL soon!! If you think that’s a good idea, let me know! Also, if you want to watch our first video you can check it out here! Please subscribe to my YouTube Channel if you haven’t already to give me more opportunities for fun giveaways and better review material for all of you : )

 

 

Our 4th of July Pictures:

4thofjulyinpictures2015-leahtackles.jpeg IMG_8219 IMG_8218 IMG_8217 IMG_8216 IMG_8240 IMG_8239 IMG_8223 IMG_8222 IMG_8221

Here are our 4th of July pictures from 2014!

Thank you for reading!! Have a wonderful week! Please, don’t forget to subscribe! xo

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: 4th Of July 2015, Captain America, Cosplay Captain America, family blogger, family fun, Family Picures, Family Vloggers, Independence Day, leah tackles, Leah Tackles 4th of July, Leah Tackles Family, Lifestyle Blogger, Mom Blogger

Logan Sullivan is 3 Months Old!! Baby AND Body Update!

April 13, 2015 & 4 Comments

Hi there! Happy Monday!

Logan turned THREE months old on Saturday! I can’t believe that my last baby is already 1/4 of a year old. AH! Today I want to share an update on how he is doing (spoiler: he’s awesome!) and how I’m doing after baby. If you have any quesitons about the newborn-3 month stage as far as baby or postpartum for mom, feel free to ask in the comments. If you enjoy these types of post, let me know as well because I can do some sort of baby/kid/mom series if there is interest : )

LOGAN UPDATE:

Stats:

Logan weighs about 15 lbs!

Length? He is definitely getting longer!

Size 6 month pants

Size 6/9 month tops

Size 3 diapers (he now shares with his older bro!)

Likes:

Laughing

Eating (nursing)

Smiling

Rolling front to back (or halfway rolling most days)

Watching his siblings

Riding in the car

Being worn in the Ergo (work like a CHARM for tears!)

Kicking his feet

Watching mommy on the treadmill

Dislikes:

Being hungry

Wet diapers

Being set down

LEAH UPDATE:

Body:

I fit into my clothes, but my body is nowhere near where it was or where I would like it to be. I would like to lose some weight, but more than that I would like to get toned again. I finally got back into the gym, but with three little little kids at home, it is very hard to get there regularly. So far I have been going once/week and I just started running (well sort of running!) on the treadmill this past week. My first time back on the treadmill was NOT pretty! I decided to do the Couch to 5K again, and if anyone would like to do it with me, let me know : ) I always feel SO much better after a run, it is so good for my stress control, and my thighs like it too.

Diet:

When you have a newborn (especially if you’re breastfeeding) you are really hungry and the LAST thing on your mind is fixing healthy meals. For the first month I pretty much survived off PB&J sandwiches and Digorno pizzas. True story. About a month ago I decided I couldn’t go on this way, it wasn’t good for my body or attitude, so I overnight switched to a super high protein diet and my milk supply plummeted. You wouldn’t think it would make that big of a difference, I wasn’t calorie counting and I was still taking in a lot of calories, but way less fat. I added fat back in, both good and bad, by taking shots of olive oil (not quite as awful as it sounds, but you’ll need a chaser!), eating nuts, and adding back in some cheesy pizza on occasion. Adding fat and calories back in worked and my milk supply thankfully went back up. I could easily do an entire post on the things I do and supplements I take to increase my milk supply if there is interest in that also. I store lots of breastmilk. LOTS.

On Wednesday I am going to be sharing what I eat on an average day, and I also am making a quick YouTube video on my new Leah Tackles YouTube channel showing what I eat. I am not a dietitian or doctor (but my mom and dad are respectively– haha hi parentals!) but I am more than happy to share what I personally do.

General:

Three kids under four is hard. NO JOKE. But I am really enjoying so many special moments with them, and I am *so* excited for lots of summer for as a family of 5! I find myself feeling very confident in my parenting decisions now, and that is somehow so freeing. I can’t wait to get to know Logan’s little personality just like I got to do with Hailey and Connor.

Husband:

Thank goodness Stephan is a huge help. Single ladies: Marry a guy who will pitch in! People say to marry a guy who loves kids, but Stephan wasn’t a kiddo whisperer or anything before becoming a dad, but he is AMAZING with our kids. I think marrying a guy who will help you out is key. He changes diapers, wipes boogers, does dishes, rocks babies, fixes boo-boos, puts away laundry, the list could go on and on. Right now he is making Hailey dinner and feeding Connor. Seriously! The difference it makes is huge. I love that it is 2015 and our kids get to see us parent as a team.

And now, the PICTURES:

: ) : ) : )

<3 <3 <3

loganupdatepics-leahtackles.jpeg IMG_4127loganupdatepics-leahtackles.jpegIMG_5677

IMG_5257 logan3monthupdatepictures-leahtackles.jpeg IMG_5662 IMG_5600 IMG_5503 IMG_5500 IMG_5323

As always, thank you so much for reading! If you like my posts, please subscribe to my blog! I love you all!

*EDIT: Hailey painted her nails (completely on her own without me knowing! Whoopsies!) and told me she wanted me to put them on my blog!!! She doesn’t really know what it is, but she hears me talk about it a lot. Hails, this is for you! I love you so!!

haileysnails-leahtackles.jpeg

FacebookTwitterEmailPinterestShare

Filed Under: Cooking, Exercise, Family Tagged With: 3 Month Baby Update, 3 Month PostPartum Update, Baby Update, Body After Baby, Diet, family blogger, family of 5, fitness, leahtackles, Lifestyle Blogger, mommy blogger

Christmas Pictures Post!!!

December 29, 2014 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a WONDERFUL Christmas if you celebrate and a wonderful holiday season no matter what you celebrate!! I lovelovelove Christmas and our tree will be up until the Epiphany on January 6th…even though this year that is making me a *little* nervous since baby boy is due January 9th! We saw Stephan’s parents on Christmas Eve, spent Christmas Day with just our little family, saw Stephan’s extended family on the 26th, and finally on the 27th we celebrated with my parents! We also had a small co-ed “Sprinkle of Love” for our baby boy over the weekend and that was such a great time! We are blessed!! Today I want to share some pictures and send love from my family to yours!! On Wednesday be ready for some of my favorite gifts of Christmas 2014!!

christmaseveOOTD-preppypinkshop-leahtackles.jpeg

decoratingcookies-christmas2014-leahtackles.jpeg

 

christmaseve2014-leahtackles.jpeg

christmaseve-leahtackles.jpeg

uncleshane-leahtackles-christmas2014.jpeg

mistletoekisses-leahtackles-christmas2014.jpeg

santacame-leahtackles.jpeg

kidkraftdollhouse-leahtackles-christmas2014.jpeg

cozycoupetruck-leahtackles-christmas2014.jpeg

christmas2014-leahtackles.jpeg

openingchristmasgifts-leahtackles.jpeg

connordavid-christmas2014-leahtackles.jpeghottiehubs-leahtackles-christmas2014.jpeg

connordavid-christmas2014-leahtackles.jpeg

haileyandpaige-christmas2014-leahtackles.jpeg

haileyandconnor-leahtackles-christmas2014.jpeg

haileychristmas2014leahtackles.jpeg

leahandsteph-leahtackleschristmas-2014.jpeg

leahtackleschristmas2014-leahtackles.jpeg

leahtackleschristmas2014.jpeg

girlfamilypic-leahtackleschristmas2014.jpeg

leahtacklessprinkle.jpeg

christmasjammies2014-leahtackles.jpeg

*Note: My Christmas Eve Outfit (pictured in the first photo at the very top of this post) is from Preppy Pink Shop! I did an entire blog post gushing on about her skirts, which you can find here, because she absolutely deserves it! She is fabulous, her work is fabulous, and I can’t wait to wear more of her skirts once I’m back in non-maternity clothes!!

Thank you for being a part of my life! Please subscribe and share! I am so excited for 2015!!! I want to take leahtackles places…starting with Etsy and Youtube!! MUUUUUAH!

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: beauty blogger, christmas 2014, family blogger, family christmas, fashion blogger, leah tackles, leah tackles christmas 2014, Mom Blogger, Preppy Pink Shop, Preppy Pink Shop Skirts

LAST MINUTE STOCKING STUFFER IDEAS *VIDEO*!!!!

December 22, 2014 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a great weekend!! There are still a couple of shopping days before Christmas and I want to share some last minute stocking stuffer ideas for those of you who may not quiiiiite be done yet. As I said awhile back, I am going to be launching both an Etsy store AND a YouTube channel in 2015….eeep! I am very excited, but also nervous! Today I decided to film a quick video on my phone showing you what I have in the stockings for Connor, who just turned 2, and Hailey, who is 3 1/2.

*Note: I almost did not upload this! I am a perfectionist and I apologize for the low quality of this video! Just after filming it today I’ve already discovered a few things to do for next time, but I think that by putting this up I will force myself to research, practice, and learn to make what I hope to be very high quality and enjoyable videos. I have been researching and learning as much as I can, and there is so much to learn, but I know by posting this first video I will be eager to get my channel set up, and start filming NON-iPHONE videos in the future : ) So, watch this quickly because I’m sure I’ll eventually put this craptastic video on private ; ) Thank you SO much for all of the support, and please please please go watch and subscribe (if you have a gmail email, you have a YouTube! Just click the red subscribe button)!!

 

CHRISTMAS STOCKINGS 2014:

FIRST YOUTUBE VIDEO-LAST MINUTE STOCKING STUFFER IDEAS 

christmasstockings2014-leahtackles.jpeg

Connor-2 Years Old:

connorsstocking2014-leahtackles.jpeg

Hailey-3 1/2 Years Old:

haileysstocking2014-leahtackles.jpeg

Phew! A video up before 2015!! That was my brave thing for the day ; ) What will yours be?! I hope you have a fantastic Monday and good luck with any Christmas prep you have left to do! I have lots of baking and wrapping to do still…annnnd I really need to get on packing for the hospital since baby could be here any day now!! Talk to you Wednesday!! XOXO

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: christmas 2014, christmas stockings, family blogger, last minute stocking stuffers, leah tackles, mommy blogger, stocking stuffer ideas, stocking stuffers for boys, stocking stuffers for girls, stocking stuffers for pre-schoolers, stocking stuffers for toddlers


SUBSCRIBE

Leave your email to subscribe!

SEARCH

SPONSORS

ARCHIVES

GRAB MY BUTTON


copy & paste code

site design by The Kinch Life Design & development by Olive & Ivy Design

Catch The Webinar Replay! Boundary Setting For Entrepreneurs

Go to leahtacklessocial.com and sign-up for the link!