Leah Tackles

  • Home
  • About
  • Policy
  • Beauty
  • Fashion
  • Cooking
  • Exercise
  • DIY Projects
  • Decor
  • Book Club
  • Family

POPSUGAR MUST HAVE BOX JANUARY 2015!!

January 21, 2015 & 3 Comments

Hi there! Happy Wednesday!

I finally got my hands on my PopSugar Must Have Box for January! My sweet friend (hey girl hey you know who you are! Don’t spit out your coffee if you’re at work!) got her box a whole week before me and we live in the same state. Hmm! So, the dates of delivery really seem to vary, but *usually* the PopSugar box usually arrives between the 10th-15th of every month for me…it ships from California via FedEx Smart Post, which means it goes out FedEx but arrives to my P.O Box.

If you don’t know, the box contains full size, premium quality items in all different categories: food, beauty, fashion, home, and sometimes an extra goodie too! Each box boasts a retail total of $100 or more. You can check out my review of the PopSugar Must Have Box for December 2014 here.

I didn’t get the sheet with information about what inspired each product, which was a bit of a bummer because I like jumping into the box and being surprised but then reading about each item. I looked up this months inspirations for the box and it said, “Rejuvenate, Fresh Start, Snow, Glimmer, Energize and Refresh”.

 

January 2014 Must Have Box:

popsugarmusthavebox-january2015-leahtackles.jpeg

Pom Pom Hat by Jack + Lucy

jackandlucy-popsugarmusthavebox-leahtackles.jpeg

I love this!! It’s a bit slouchy and more “hipster” than what I normally would wear, but it is super cute on!! I looove to wear gray and the pom pom is right up my ally! We got tech gloves Jack + Lucy in the January box for 2014 that I wear all the time and they’ve held up really well.

$32

12 oz Brew Glass Coffee Cup by KeepCup

keepcup-popsugarmusthave-leahtackles.jpeg

I love this! First of all, it fits under my Keurig which is great because a lot of travel mugs do not. The idea is that you can take these cups to your favorite coffee shop and they are the correct size for consistent proportions. I am curious about taking a cup like this to Starbucks…has anyone done this or tried to? But let’s be real, I usually am drinking/making coffee at home, and so I can definitely get a lot of use out of it.

$26

Skin Jewel Tattoos

skinjeweltattoos-leahtackles-popsugarmusthavebox.jpeg

I started seeing these last summer, and I’ll be honest the first time I saw them is when all of the girls on the total guilty pleasure of a show, Bachelor in Paradise, were rocking them. I think they’re fun, and would definitely wear a few on my wrists in the summer when I have a bit of a (fake) tan. Also, where were these when I was in college?! How freaking cute! I would have definitely worn these alllllll summa long at the pool.

$18

Protein Gronola in Peanut Butter N’ Dark Chocolate by Nature Valley

I am breastfeeding a newborn, so I am constantly needing simple snacks because I get so hungry so fast, and I think this will be a great option. I tried it and it tastes good, I bet it will be amazing with milk or almond milk!

$3.70

eQua Yoga Hand Towel by manduka

I am excited about this one! Once I get the all clear from my doctor to workout again after baby, I can’t wait to get back into shape, and this will be an awesome gym towel!! It says yoga but I can see myself using this after the treadmill or machines.

$16

Ice Water Eyes by ToGoSpa

icewatereyes-togospa-popsugarmusthave-leahtackles.jpeg

I love these! Did they know that I just gave birth?! Look for these in an upcoming Empties post where I let you know how they worked for me. I am hopeful ; )

$12.50

Ultra Repair Cream by First Aid Beauty

I keep seeing First Aid Beauty, and this product in particular, mentioned on other blogs I read and on YouTube videos that I watch but until now I haven’t had anything from the brand. I am thrilled to have this and can’t wait to try it out. And this is the big size, so it’s pretty nice that they gave us that and not the smaller $12 tube that is also avaliable.

$30

This box had a retail value of $138.20 and I think I will get use out of every single item in the box! I love PopSugar because it is a nice way to pamper yourself with things you probably wouldn’t buy yourself otherwise or may not know about otherwise. Do you subscribe to PopSugar? If you’d like more information you can find that right here! If you subscribe, did you enjoy your box? Please *COMMENT* to let me know!!! : )

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Cooking, Exercise, Fashion Tagged With: beauty blogger, eQua, fashion blogger, FIrst Aid Beauty, Ice Water Eyes, jack + lucy, Keep Cup, leah tackles, Lifestyle Blogger, Must Have Box, nature valley gronola, Pop Sugar Must Have Box, popsugar, Skin Jewel Tattoos, SpaToGo, subscription box, Ultra Repair Cream First Aid Beauty

Ipsy Glam Bag January 2015!!

January 19, 2015 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a wonderful weekend! Today I want to share my Ipsy bag for January 2015! If you don’t know, Ipsy Glam Bag is a $10/month subscription where you get 4-5 deluxe size samples or sometimes full size products in makeup, hair, nails, and skincare. Do you subscribe to Ipsy? I would love to hear about what you thought of your bag this month!!

 

January Ipsy Glam Bag:

ipsy-glambag2015-leahtackles.jpeg

Bag and Theme:

ipsyglambag-jan2015-leahtackles.jpeg

I love the bag! I think it’s pretty summery with the coral and bright blue, but I don’t mind looking at those bright colors on these gray January days!! The theme is “Fresh Start” which is of course super approriate for the start of 2015! I am ready for an amazing 2015 : )

Elizabeth Mott All Over Shadow Brush:

At first glance I was pretty hesitant about this brush and I will admit that I was judging a book  brush by its pink color, but it is a really nice brush!! This is made with synthetic hairs, is very densely packed, and is very soft! This will be a welcomed addition to my brush collection, and at a $9.99 price point it alone pays for this months bag.

Hikari Eye Liner in Storm:

ipsyglambag.jpeg

Right away I love that this doesn’t require a sharpener! I keep getting these gray metallic and gunmetal shades of eye liners, and I mostly wear black or dark brown, but I’ll give it a shot. I am not too impressed with the pigmentation…a really deep slate gray or gunmetal would be fun, but this I would probably only use as an accent to a look every once in a blue moon.

Pacifica Eye Shadow in Ethereal:

ipsyglambag-pacifica-leahtackles.jpeg

Even though this is a color that I could easily dupe with other colors in my makeup collection, I love that this is small because it will be great to throw into overnight bags for quick trips. A very pretty basic!

Velvet 59 by Paris Manning in Noisette:

ipsy-glam-bag-january-2015-leahtackles.jpeg

I wasn’t sure if I would like this, it looked pretty brown, but it’s actually a really pretty nude gloss!! It is a bit sticky, which I don’t mind on days when I want a gloss that will have a little more staying power. I am not a fan of the brush hair applicator, but this one didn’t bother me on the inital application. This smells like roses, but it isn’t too strong or off-putting at all. Hailey REALLY liked trying this on!

Eco-Beauty good day. day moisturizer:

I am excited to try this! It’s a pretty small sample, but at least it isn’t a tiny foil packet (how can you possibly get any idea with most of those?! ah!) and I will be able to try it out for a couple of days.

Once again, I am satisfied with my $10 spent! Do you subscribe to Ipsy? What did you think of your bag this month? If you’re interested in more information, you can find it here.

Thank you for being here! I truly appreciate each and every one of you!! Please share and subscribe if you learned something, found this useful, fun, or just want to be nice ; ) It’s easy I promise! Just enter your email in the subscription box on the right hand side of this screen and you’ll get an email to confirm the subscription! To share, use the links at the bottom of this post to share easily on social media! Have a wonderful week!!!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty Tagged With: beauty, beauty blog, beauty blogger, eco beauty, elizabeth mott all over shadow brush, hikari, ipsy bag january 2015, Ipsy Glam Bag, leah tackles, makeup, pacifica eye shadow, Subscription Bag, subscription box, velvet 59

Meet Our Newest, Littlest Love!

January 14, 2015 & 2 Comments

Hi there! Happy Wednesday!

I am OVER THE MOON happy to introduce you to our new baby, Logan, who arrived on January 11th weighing 9 lbs 4 oz (!!!) and measuring 21 1/2 inches!

Due Date January 9th, 2015:

duedate-logan-leahtackles.jpeg

 

Logan is here!!!!!!!!!!

newborn-logan-leahtackles.jpeg

newbornlogan-leahtackles.jpeg IMG_3129 IMG_3132 IMG_3143

logannewborn-leahtackles.jpeg FullSizeRender (8) IMG_3180 FullSizeRender (9) FullSizeRender (10)

Hailey. Connor. Logan.

mybabies-leahtackles.jpeg
FullSizeRender (11) IMG_3233

newborn-logan-leahtackles.jpeg IMG_3310

 

Thank you for letting me share our blessing with you!! I hope you don’t mind a few more picture posts popping up in the next few weeks ; ) Please subscribe to make Logan’s mommy reeeally over-the-top joyful!!

 

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: baby boy, leah tackles, Lifestyle Blogger, logam, mommy blogger, newborn baby

If it makes you happy…

January 12, 2015 & 4 Comments

Hi there! Happy Monday!

Who remembers that song “If It Makes You Happy” by Sheryl Crow? When I decided that I wanted to share a few things in my room that make me happy, I couldn’t get that song out of my head! I am a big believer in making life as beautiful, enjoyable, and special as possible…life is short! Surround yourself in pretty things! A quick DIY or some washi tape can completely change something from ordinary to fab!! Thank you for being here! I hope that you had a wonderful weekend! *Hopefully* I have a brand new baby boy in my arms when you’re reading this, but as I write this he still hasn’t made his appearance. I will definitely be doing an introduction post to our new little man as well! Get ready for some picture posts!!

 

prettylittledetails-jewelrycatchall-leahtackles.jpeg

sequinhanger-leahtackles-prettythings.jpeg

pearlsandpastries-leahtackles-prettystuff.jpeg

essielove-leahtackles.jpeg

prettydetails-leahtackles.jpeg

leahtackles-prettylittlethings.jpeg

popfizzclink-prettylittlethings.jpeg

erincondren-leahtackles.jpeg

henribendelsnowglobes-leahtackles.jpeg

prettymakeupdrawer-leahtackles.jpeg

What pretty things do you surround yourself with? What have you been loving lately? I would *love* to hear from you! Enable me ; ) Have a great start to your week!! And please comment, subscribe, and share!!! It means SOOOOMUCH to me!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Decor, DIY Projects, Fashion Tagged With: bauble bar, baubles, beauty blogger, erin condren, essie, essie nail polish, fashion blogger, frixion color, jewelry, leahtackles, Lifestyle Blogger, pearls and pastries, Pop Sugar Must Have, washi tape

Products I’ve Used Up?! January Empties! Part 2

January 7, 2015 & Leave a Comment

Hi there! Happy Wednesday!

Today I will be continuing my post from Monday, Products I’ve Used Up?! January Empties! Part 1, and sharing if I would repurchase, and a mini review.

 

Empties Part 2:

januaryempties-productsiveusedup-leahtackles.jpeg

Urban Decay De-Slick Makeup Setting Spray:

I love the Urban Decay makeup setting sprays, I have already repurchased one but I picked up All-Nighter this time instead of De-Slick.

Maybelline Dream Wonder Powder in 10 Porcelain Ivory:

I love this powder! It is fantastic for setting my foundation, and adds a little extra coverage. I have already repurchased this.

Orajel Training Toothpaste Fluoride-Free in Berry Fun:

This is for the kiddos, and we have already repurchased it! We are getting Hailey ready for “big girl” toothpaste but continue to use this for Connor.

O•P•I Drip Dry Drops:

I ran out of these so long ago and seriously need to repurchase them! These drops help dry your nails SUPER fast when you’re rushing! I don’t use them every time I paint my nails, I do find they dull the shine just ever ever ever so slightly, but they’re amazing for when you don’t have forever to sit around waiting for your nails to dry!!

Pureology Serious Colour Care Antifade Complex Shampoo:

I love these shampoos! I have not repurchased, but have a different Pureology shampoo in my shower.

Palmer’s Cocoa Butter Formula Massage Cream for Stretch Marks:

I used this during this pregnancy and I do like it for my belly, breasts, and buns! But I did not repurchase it because I opted to use an oil by Burt’s Bees.

Colgate 360 Toothbrush:

These are my favorite toothbrushes! For 2015 I would like to get us some nice electric toothbrushes, but these are my standbys for sure! Any suggestions for a great electric toothbrush would be apprecaited! Let me know in the comments if you have a favorite!

Neutrogena Norwegian Formula Hand Cream:

I really like this hand cream in the winter months. I didn’t like it at first because I was using too much, but if you use just a pea sized dab works beautifully! I will repurchase!

Briogeo Don’t Despair, Repair Deep Conditioning Hair Mask:

I only had a small sample of this, so I only got a couple of uses out of it, but I did enjoy it! I don’t plan to repurchase it because there are lots of other hair marks I have on my “to try” list, but this did seem nice.

Estée Lauder Advanced Time Zone Age Reversing Line/Wrinkle Eye Cream:

I got a sample the last time I went to purchase my Estée Lauder staples and I did enjoy this eye cream, but I have not repurchased it.

H2o+ Face Oasis Hydrating Treatment:

This was a small sample from my Ipsy Glam Bag but I got quite a few uses out of it. It is a gel consistency, it felt hydrating, and did not break me out. I would consider purchasing this in the future, I think it would feel great in the summer!

Patagonia Ayres Body Butter with Essential Oils Jasmine and Rosemary:

This was another small sample, but I did enjoy the rich formula and the scent was very relaxing.

Anastasia of Beverly Hills Brow Wiz in Medium Ash:

I adore this and it has already been repurchased this! This will help you make sure that your brows are on fleek (on point!) : )

Thank you SO much for being here, reading, and for the continued support! Please be sure to subscribe! It’s easy, just enter your email in the box that says “subscribe” and you will get an email to confirm your subscription! Thank you!!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty Tagged With: anastasia of beverly hills, beauty blogger, briogeo, colgate, empties, estee lauder, h2o+, january empties, leah tackles, makeup blog, maybelline, neutrogena, OPI drip dry drops, orajel, palmers cocoa butter, patagonia ayres body butter, products I've used up, products ive used up january 2014, pureology, urban decay

Products I Used Up?! January 2015 Empties! Part 1

January 5, 2015 & 1 Comment

Hi there! Happy Monday!

I have been saving all of my empty beauty and tolietries in a basket in my closet for awhile now so that I could share an empties post with you! I love reading these types of post and watching these types of videos because 1) It’s helpful to hear if people would repurchase or not and a quick mini review, and 2) Let’s be honest, isn’t everyone just a *tiny* bit nosy?! It’s fun to see!

Let’s get into it!

 

January Empties:

januaryempties-productsiveusedup-leahtackles.jpeg

Estée Lauder Advanced Time Zone Night Age Reversing Line/Wrinkle Cream:

Fabulous, thick, and luxurious night cream! This lasts because a small amount goes a long way. This has already been repurchased (by my momma for Christmas! Thank you!!) and will be for a long time! Love!

Estée Lauder DayWear Advanced Multi-Protection Anti-Oxidant Cream with Broad Spectrum SPF:

Same as the above! I love this and it is my favorite moisturizer. It is PERFECT for my combo/oily skin.

Gillette Venus Spa 3 Blade Shave Gel Bars:

I have been using Venus razor blades forever! I love the build in gel bar because it saves me so much time!

Bath and Body Works Sweet Pea Fine Fragrance Mist:

I don’t really like body sprays, I am definitely a perfume girl, but I like using a body spray in the evenings as part of my nighttime routine or sometimes when I’m just getting out of the shower or bath. I was glad to use this up and I won’t be repurchasing it, but not because there is anything bad about it.

Bath and Body Works Japanese Cherry Blossom Fine Fragrance Mist:

Same exact review as above!

Kleenex Hand Towels:

I use these to dry my face after cleansing because it is much more sanitary than using a towel. I love these and have already repurchased more.

Caress Evenly Gorgeous Burnt Brown Sugar & Karite Butter Exfoliating Body Wash:

I LOVE THIS! I will repurchase this over and over!! It smells amazing, exfoliates beautifully, and feels just as fabulous as a more expensive body wash. Awesome!

Burt’s Bees Baby Bee Nourishing Baby Oil:

I am SUPER pregnant (maybe when you read this I won’t be anymore?! maybe?!) and I like slathering this on my belly, breasts, butt…all the areas prone to dryness and strech marks. They make a Mama Bee Oil, which I also like, but this works just as well for me.

Lollia At Last Perfumed Shower Gel with White Petals & Rice Flower:

I got this in one of my PopSugar Must Have Boxes. I liked this, but I would not repurchase because I do not think that it was anything that special for the price point.

Dove Clinical Protection Clear Tone Deodorant Solid:

I love the clinical strength deodorants for the peace of mind, and will continue to purchase this.

Equate Sensitive Skin Feminine Wash in Soft Petal:

Using a special feminine wash or completely scent free soap is so important…gotta protect those lady bits! I have used both this brand, the Walmart brand, as well as the Summer’s Eve and like them equally.

Dr. Scholl’s For Her Rub Relief Gel Spots for Tartgeted Blister Protection:

I love these in my heels and flats! I have even put them in my husbands Sperry’s! These work so well!

Garnier Fructis Style Volumizing Anti-Humidity Hairspray:

I really like this hairspray for a light hold and daily use.

Philosophy Eye Hope Multitasking Eye Cream for Dark Circles, Puffiness & Lines:

I love this! I have not repurchased it yet, but I would in the future.

Benefit It’s Potent! Eye Cream:

I have been using this for a couple of years now as part of my morning routine. I really like this because I have VERY dark circles from a combination of genetics and mommyhood and this really helps.

Phew! That was a lot and that was only part 1! Thank you so much for reading : )

FacebookTwitterEmailPinterestShare

Filed Under: Beauty Tagged With: bath and body works, beauty blogger, beauty products, benefit, Burts Bees, caress body wash, dr scholls, equate, estee lauder, garnier, gillette, january empties, kleenex hand towels, lollia shower gel, philosophy eye hope, products I've used up, sephora, ulta

What I Got For Christmas 2014!!

December 31, 2014 & Leave a Comment

Hi there! Happy Wednesday! And Happy New Year’s Eve!

Today I want to share some of the wonderful gifts that I was lucky enough to get from loved ones for Christmas. As a disclaimer: I am in no way bragging! I feel *extremely* blessed to have been given these things, and hope that you enjoy seeing posts like this! I love to read and watch “What I got For Christmas” posts and videos, and I hope you do too! If not, that’s okay too : )

What I Got For Christmas 2014:

whatigotforchristmas2014-leahtackles.jpeg

 

#1 The Selfie by Gabba Goods:

I think this is such a fun little gadget and can’t wait to try it out! I am not sure it will help much with selfies, it isn’t like those little sticks that you can put your phone on, but I think it would be great for group selfies for sure!! I love this…hopefully this will improve my Instagram ; )

#2 Sticks Stones Necklace by Love Nail Tree:

This necklace is so unique and stunning! I love that it’s simple but a longer style. I can’t wait to style this!!!

#3 Nirvana White Rollerball by Elizabeth and James:

I have been wanting this for a long time now!! I love the Nirvana Black as well, and think I will add it to my collection soon. I also was a huuuuge Mary-Kate and Ashley fan when I was little, so it’s fun that this is from their high-end brand. On another note, have you SEEN the Elizabeth and James jewelry line?! *SWOOOON!*

#4 Cranberry and Gray Scarf, Headband, and Gloves by Coach:

This was such a great gift because  I wouldn’t gravitate towards this cranberry color, but I am really enjoying it! I love it with the gray, one of my favorite colors to wear, and love that each of these pieces are just as gorgeous worn on their own. The gloves aren’t tech gloves, but they do fold back for easy touch screen use.

#5 Full Frontal Lipstick Stash Set by Urban Decay:

urbandecayfullfrontalrevolutionlipsticks-leahtackles.jpeg

I have one Urban Decay Revolution lipstick that I adore, so I was super excited to get this set. These mini lipsticks are adorable and I don’t mind that they’re small because it isn’t often that I actually use up a lipstick! Gorgeous, pigmented, creamy lipsticks in STUNNING shades!!

#6 Life Planner and Accessories by Erin Condren:

erincondrenlifeplanners-leahtackles.jpeg

I wish I could explain this planner to you but I think this will deserve an entire blog post or maybe even a video! This planner is EVERYTHING you could want in a planner! Also, Erin Condren the creator of the Life Planner is a Delta Gamma like me : ) Seriously, I know it may be a bit late to order a planner, but this would be worth ordering and getting a bit late. There are tons of options, they have custom options, and tons of fun accessories. I can’t wait to start using this!!!

As always thank you for reading!! If you have already subscribed, thank you! If you haven’t, please do and make my day! You can find me on social media by using the buttons at the bottom of this post or at the top of this page!!

FacebookTwitterEmailPinterestShare

Filed Under: Beauty, Fashion Tagged With: beauty blogger, christmas gifts 2014, coach, elizabeth and james, erin condren, erin condren life planner, love nail tree jewelry, nirvana white, sephora, the selfie by gabba goods, urban decay revolution lipstick, what i got for christmas, what i got for christmas 2014

Christmas Pictures Post!!!

December 29, 2014 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a WONDERFUL Christmas if you celebrate and a wonderful holiday season no matter what you celebrate!! I lovelovelove Christmas and our tree will be up until the Epiphany on January 6th…even though this year that is making me a *little* nervous since baby boy is due January 9th! We saw Stephan’s parents on Christmas Eve, spent Christmas Day with just our little family, saw Stephan’s extended family on the 26th, and finally on the 27th we celebrated with my parents! We also had a small co-ed “Sprinkle of Love” for our baby boy over the weekend and that was such a great time! We are blessed!! Today I want to share some pictures and send love from my family to yours!! On Wednesday be ready for some of my favorite gifts of Christmas 2014!!

christmaseveOOTD-preppypinkshop-leahtackles.jpeg

decoratingcookies-christmas2014-leahtackles.jpeg

 

christmaseve2014-leahtackles.jpeg

christmaseve-leahtackles.jpeg

uncleshane-leahtackles-christmas2014.jpeg

mistletoekisses-leahtackles-christmas2014.jpeg

santacame-leahtackles.jpeg

kidkraftdollhouse-leahtackles-christmas2014.jpeg

cozycoupetruck-leahtackles-christmas2014.jpeg

christmas2014-leahtackles.jpeg

openingchristmasgifts-leahtackles.jpeg

connordavid-christmas2014-leahtackles.jpeghottiehubs-leahtackles-christmas2014.jpeg

connordavid-christmas2014-leahtackles.jpeg

haileyandpaige-christmas2014-leahtackles.jpeg

haileyandconnor-leahtackles-christmas2014.jpeg

haileychristmas2014leahtackles.jpeg

leahandsteph-leahtackleschristmas-2014.jpeg

leahtackleschristmas2014-leahtackles.jpeg

leahtackleschristmas2014.jpeg

girlfamilypic-leahtackleschristmas2014.jpeg

leahtacklessprinkle.jpeg

christmasjammies2014-leahtackles.jpeg

*Note: My Christmas Eve Outfit (pictured in the first photo at the very top of this post) is from Preppy Pink Shop! I did an entire blog post gushing on about her skirts, which you can find here, because she absolutely deserves it! She is fabulous, her work is fabulous, and I can’t wait to wear more of her skirts once I’m back in non-maternity clothes!!

Thank you for being a part of my life! Please subscribe and share! I am so excited for 2015!!! I want to take leahtackles places…starting with Etsy and Youtube!! MUUUUUAH!

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: beauty blogger, christmas 2014, family blogger, family christmas, fashion blogger, leah tackles, leah tackles christmas 2014, Mom Blogger, Preppy Pink Shop, Preppy Pink Shop Skirts

MERRY CHRISTMAS (EVE)!

December 24, 2014 & Leave a Comment

Hi there! Happy Wednesday! And more importantly, Merry Christmas Eve to all those who celebrate! Thank you so much for supporting me and my little blog!! It means so much to me!

I hope you have a WONDERFUL day tomorrow with loved ones!!

I’m off to create some Santa magic ; )

 

merrychristmaseve-leahtackles.jpeg

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: leah tackles, leahtackles christmas, merry christmas eve

LAST MINUTE STOCKING STUFFER IDEAS *VIDEO*!!!!

December 22, 2014 & Leave a Comment

Hi there! Happy Monday!

I hope that you had a great weekend!! There are still a couple of shopping days before Christmas and I want to share some last minute stocking stuffer ideas for those of you who may not quiiiiite be done yet. As I said awhile back, I am going to be launching both an Etsy store AND a YouTube channel in 2015….eeep! I am very excited, but also nervous! Today I decided to film a quick video on my phone showing you what I have in the stockings for Connor, who just turned 2, and Hailey, who is 3 1/2.

*Note: I almost did not upload this! I am a perfectionist and I apologize for the low quality of this video! Just after filming it today I’ve already discovered a few things to do for next time, but I think that by putting this up I will force myself to research, practice, and learn to make what I hope to be very high quality and enjoyable videos. I have been researching and learning as much as I can, and there is so much to learn, but I know by posting this first video I will be eager to get my channel set up, and start filming NON-iPHONE videos in the future : ) So, watch this quickly because I’m sure I’ll eventually put this craptastic video on private ; ) Thank you SO much for all of the support, and please please please go watch and subscribe (if you have a gmail email, you have a YouTube! Just click the red subscribe button)!!

 

CHRISTMAS STOCKINGS 2014:

FIRST YOUTUBE VIDEO-LAST MINUTE STOCKING STUFFER IDEAS 

christmasstockings2014-leahtackles.jpeg

Connor-2 Years Old:

connorsstocking2014-leahtackles.jpeg

Hailey-3 1/2 Years Old:

haileysstocking2014-leahtackles.jpeg

Phew! A video up before 2015!! That was my brave thing for the day ; ) What will yours be?! I hope you have a fantastic Monday and good luck with any Christmas prep you have left to do! I have lots of baking and wrapping to do still…annnnd I really need to get on packing for the hospital since baby could be here any day now!! Talk to you Wednesday!! XOXO

FacebookTwitterEmailPinterestShare

Filed Under: Family Tagged With: christmas 2014, christmas stockings, family blogger, last minute stocking stuffers, leah tackles, mommy blogger, stocking stuffer ideas, stocking stuffers for boys, stocking stuffers for girls, stocking stuffers for pre-schoolers, stocking stuffers for toddlers

« Previous Page
Next Page »

SUBSCRIBE

Leave your email to subscribe!

SEARCH

SPONSORS

ARCHIVES

GRAB MY BUTTON


copy & paste code

site design by The Kinch Life Design & development by Olive & Ivy Design